PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A01G1274
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 281aa    MW: 30978.7 Da    PI: 9.4198
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A01G1274genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.43.1e-4124100278
                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  C v+gC+adls++++yhrrhkvCevhsk+p+v+++g+eqrfCqqCsrfh l efDe+krsCr+rL++hn+rrrk+q+
  Gh_A01G1274  24 CLVDGCTADLSQCRDYHRRHKVCEVHSKTPKVIIRGQEQRFCQQCSRFHCLVEFDEGKRSCRKRLDGHNRRRRKPQP 100
                  **************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.7E-341785IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.4282198IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-3822102IPR004333Transcription factor, SBP-box
PfamPF031105.5E-302497IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MEPSSSAPFK RARPPGNRNQ VPSCLVDGCT ADLSQCRDYH RRHKVCEVHS KTPKVIIRGQ  60
EQRFCQQCSR FHCLVEFDEG KRSCRKRLDG HNRRRRKPQP QPHSLSVNPG RCLSNLQGSR  120
HLPSSSPQIF ATTAITSSWL GTARMEPDIG SESSRNGFFS GSFPHSYKRE EQLSLLQTNH  180
SSLHGVSVYQ LPLLSNGVGS SRKMFSNAID SDRALSLLSS QPAETREIGL KPMVQSGPTS  240
SLIPNMQYNG VAMEGEHVLA TDGNGNTNID GQEMFGSANG T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-3024971184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18097KRSCRKRLDGHNRRRRKP
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223160.0KJ622316.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL8) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012467335.10.0PREDICTED: squamosa promoter-binding-like protein 13A
RefseqXP_012467337.10.0PREDICTED: squamosa promoter-binding-like protein 13A
SwissprotQ49I555e-49TGA1W_MAIZE; Teosinte glume architecture 1
SwissprotQ49I576e-49TGA1B_MAIZE; Teosinte glume architecture 1
TrEMBLA0A0B0N2X10.0A0A0B0N2X1_G
STRINGPOPTR_0003s16780.14e-98(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41112759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.15e-49SBP family protein